PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 481aa    MW: 55374.3 Da    PI: 6.8838
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886261.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.44.6e-92844781374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl  A a+++++ ela + L++l +++s +gd++qR++ayf+ +Laa+l+ + s  y+ +  ++ts    +ee+ a+  ++ vsP+++f+h
  XP_015886261.1  84 LIHLLLVTASAINENNVELALENLNELFQTVSLNGDSVQRVVAYFADGLAAKLLTKKSPFYEMIMKKPTS----EEEFLAFMDLYRVSPYYQFAH 174
                     689**********************************************************999998886....67777777899********** PP

            GRAS  96 ltaNqaIleavege......ervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfef 178
                     +taNq+I ea+e+e      +++HiiD+d+s+G+QWp+L+q+L++ +     ++  slRiTg+g+    s eel+et++rL +f + + ++ fef
  XP_015886261.1 175 FTANQMIIEAFEKEeeeknnRALHIIDLDVSYGFQWPSLIQSLSEMAsrgggNNRISLRITGFGR----SLEELRETENRLVSFSKGFgNLGFEF 265
                     ************99888777789******************987544444544456*********....9****************99469**** PP

            GRAS 179 nvlvakrledleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                     + l+ ++ + + ++++ r k++E++aVnlv++l +l     s+++ ++e+Lk+v+sl+P +vv+ve+e ++n  sFl rf+e+l+ ++a+fdsl+
  XP_015886261.1 266 HGLLRSNNNLMMVDNIiRRKRNETVAVNLVFHLNTLD----SISK-ISETLKTVQSLNPCIVVMVEKEGSRNPRSFLSRFMESLHSFAAMFDSLD 355
                     ***888888888887637777**********999995....3333.568********************************************** PP

            GRAS 273 aklpreseerikvErellgreivnvvacegaerrer........hetlekWrerleeaGFkpvplsekaakqaklllr........kvk...sdg 348
                       lp es+er  +E+  lg+ei++++  e+++  e+        ++   +W++r+e+ GF+ ++ls+k + qaklll+        +++     g
  XP_015886261.1 356 DCLPLESSERLCIEKNHLGKEIKSMLNYEKDDDHEKisnclkydQRIETSWKARMESHGFEGIRLSSKCMIQAKLLLKirthycplQFEeenIGG 450
                     ******************************99766511111111334578**************************9733222222111111235 PP

            GRAS 349 yrveee.sgslv.lgWkdrpLvsvSaWr 374
                     ++v e+ +g ++ lgW+dr L+++SaWr
  XP_015886261.1 451 FKVVERdDGRAIsLGWQDRYLLTASAWR 478
                     7766544666667**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.66158445IPR005202Transcription factor GRAS
PfamPF035141.6E-8984478IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MEEIDEEKLL NLSLAIVTDS GGSVERKRKR IRREFGYSSS PNLFSNHEGF EGKIFRLLQQ  60
REQMLKLDHK RKGLVHEDGK GLHLIHLLLV TASAINENNV ELALENLNEL FQTVSLNGDS  120
VQRVVAYFAD GLAAKLLTKK SPFYEMIMKK PTSEEEFLAF MDLYRVSPYY QFAHFTANQM  180
IIEAFEKEEE EKNNRALHII DLDVSYGFQW PSLIQSLSEM ASRGGGNNRI SLRITGFGRS  240
LEELRETENR LVSFSKGFGN LGFEFHGLLR SNNNLMMVDN IIRRKRNETV AVNLVFHLNT  300
LDSISKISET LKTVQSLNPC IVVMVEKEGS RNPRSFLSRF MESLHSFAAM FDSLDDCLPL  360
ESSERLCIEK NHLGKEIKSM LNYEKDDDHE KISNCLKYDQ RIETSWKARM ESHGFEGIRL  420
SSKCMIQAKL LLKIRTHYCP LQFEEENIGG FKVVERDDGR AISLGWQDRY LLTASAWRCG  480
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-41894788375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886261.10.0PREDICTED: protein SCARECROW-like
TrEMBLM5VGL50.0M5VGL5_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s11540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.17e-54RGA-like 2